missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant HPV HPV 18 Protein

A cDNA sequence encoding the HPV 18 was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP12308-500ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15940009

  • € 800.00 / 500µg

Estimated Shipment: 02-02-2023
to see stock.
Add to basket

Description

Description

Specifications

Specifications

HPV HPV 18 Protein
500 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
HPV
GST
Recombinant HPV-18 solution in PBS, 3M Urea and 0.02% sodium azide as preservative.
Protein is >90% pure as determined by 10% PAGE (Coomassie staining).
Research Use Only
Recombinant Protein
E. coli
VDVYLPPPSVARVVNTDDYVTPTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMPASPGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPA
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers