missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RECQL4 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 209.00 - € 481.00
Specifications
| Antigen | RECQL4 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18654952
|
Novus Biologicals
NBP2-95219-0.02ml |
0.02 mL |
€ 209.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18671892
|
Novus Biologicals
NBP2-95219-0.1ml |
0.1 mL |
€ 481.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RECQL4 Polyclonal antibody specifically detects RECQL4 in Human, Mouse samples. It is validated for Western BlotSpecifications
| RECQL4 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Direct Reversal of DNA Damage | |
| PBS (pH 7.3), 50% glycerol | |
| 9401 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| DNA helicase, RecQ-like type 4, DNA helicase, RecQ-like, type 4, EC 3.6.4.12, RecQ protein-like 4RTS, RecQ4, RECQ4ATP-dependent DNA helicase Q4 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 231-330 of human RECQL4 (NP_004251.3). GAGSQGPEASAFQEVSIRVGSPQPSSSGGEKRRWNEEPWESPAQVQQESSQAGPPSEGAGAVAVEEDPPGEPVQAQPPQPCSSPSNPRYHGLSPSSQARA | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title