missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RMND5A Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 201.00 - € 481.00
Specifications
| Antigen | RMND5A |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18639541
|
Novus Biologicals
NBP2-94019-0.02ml |
0.02 mL |
€ 201.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18683262
|
Novus Biologicals
NBP2-94019-0.1ml |
0.1 mL |
€ 481.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RMND5A Polyclonal antibody specifically detects RMND5A in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| RMND5A | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Stem Cell Markers | |
| PBS (pH 7.3), 50% glycerol | |
| 64795 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| C-terminal to LisH motif, 44 kDa, CTLH, FLJ12753, FLJ13910, FLJ21795, MGC78451, p44CTLH, protein RMD5 homolog A, required for meiotic nuclear division 5 homolog A (S. cerevisiae), RMD5 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 200-270 of human RMND5A (NP_073617.1). ISLLMGGTTNQREALQYAKNFQPFALNHQKDIQVLMGSLVYLRQGIENSPYVHLLDANQWADICDIFTRDA | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title