missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RUVBL2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-57593
This item is not returnable.
View return policy
Description
RUVBL2 Polyclonal specifically detects RUVBL2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| RUVBL2 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| 48 kDa TATA box-binding protein-interacting protein, 51 kDa erythrocyte cytosolic protein, EC 3.6.1, EC 3.6.4.12,48 kDa TBP-interacting protein, ECP51TIP49B, erythrocyte cytosolic protein, 51-KD, INO80 complex subunit J, INO80JTAP54-beta, Repressing pontin 52, REPTIN, Reptin 52, Reptin52, RuvB (E coli homolog)-like 2, ruvB-like 2, RuvB-like 2 (E. coli), RVB2, TBP-interacting protein, 48-KD, TIH2, TIP48ECP-51, TIP49b, TIP60-associated protein 54-beta | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| RUVBL2 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ATVTDTTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGR | |
| 100 μL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 10856 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction