missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RUVBL2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 593.00
Specifications
| Antigen | RUVBL2 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18224505
|
Novus Biologicals
NBP2-57593 |
100 μL |
€ 593.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18633689
|
Novus Biologicals
NBP2-57593-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RUVBL2 Polyclonal specifically detects RUVBL2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| RUVBL2 | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 10856 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ATVTDTTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 48 kDa TATA box-binding protein-interacting protein, 51 kDa erythrocyte cytosolic protein, EC 3.6.1, EC 3.6.4.12,48 kDa TBP-interacting protein, ECP51TIP49B, erythrocyte cytosolic protein, 51-KD, INO80 complex subunit J, INO80JTAP54-beta, Repressing pontin 52, REPTIN, Reptin 52, Reptin52, RuvB (E coli homolog)-like 2, ruvB-like 2, RuvB-like 2 (E. coli), RVB2, TBP-interacting protein, 48-KD, TIH2, TIP48ECP-51, TIP49b, TIP60-associated protein 54-beta | |
| RUVBL2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title