missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SCN3A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 359.00 - € 515.00
Specifications
| Antigen | SCN3A |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
SCN3A Polyclonal specifically detects SCN3A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SCN3A | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| brain III voltage-gated sodium channel, KIAA1356, NAC3, Nav1.3, Sodium channel protein brain III subunit alpha, sodium channel protein type 3 subunit alpha, Sodium channel protein type III subunit alpha, sodium channel, voltage-gated, type III, alpha polypeptide, sodium channel, voltage-gated, type III, alpha subunit, Voltage-gated sodium channel subtype III, Voltage-gated sodium channel subunit alpha Nav1.3 | |
| SCN3A | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q9NY46 | |
| 6328 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: NRRKKRRQREHLEGNNKGERDSFPKSESEDSVKRSSFLFSMDGNRLTS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title