missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC16A12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-82789
This item is not returnable.
View return policy
Description
SLC16A12 Polyclonal antibody specifically detects SLC16A12 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
| SLC16A12 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| CJMG, DKFZp686E188, MCT 12, MCT12monocarboxylate transporter 12, solute carrier family 16 (monocarboxylic acid transporters), member 12, Solute carrier family 16 member 12, solute carrier family 16, member 12 (monocarboxylic acid transporter 12) | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: ITLKEDHTTPEQNHVCRTQKEDIKRVSPYSSLTKEWAQTCLCCCLQQEYS | |
| 0.1 mL | |
| Primary | |
| Human | |
| Purified |
| Immunocytochemistry | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 387700 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction