missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC16A12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 433.00 - € 572.00
Specifications
| Antigen | SLC16A12 |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL |
| Applications | Immunocytochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18490271
|
Novus Biologicals
NBP1-82789-25ul |
25 μL |
€ 433.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18490771
|
Novus Biologicals
NBP1-82789 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC16A12 Polyclonal antibody specifically detects SLC16A12 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| SLC16A12 | |
| Immunocytochemistry | |
| Unconjugated | |
| Rabbit | |
| Human | |
| CJMG, DKFZp686E188, MCT 12, MCT12monocarboxylate transporter 12, solute carrier family 16 (monocarboxylic acid transporters), member 12, Solute carrier family 16 member 12, solute carrier family 16, member 12 (monocarboxylic acid transporter 12) | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: ITLKEDHTTPEQNHVCRTQKEDIKRVSPYSSLTKEWAQTCLCCCLQQEYS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol | |
| 387700 | |
| IgG | |
| Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title