missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC22A2/OCT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
€ 379.00 - € 539.00
Specifications
| Antigen | SLC22A2/OCT2 |
|---|---|
| Concentration | 0.2mg/mL |
| Dilution | Western Blot Reactivity reported in scientific literature (PMID: 26045896)., Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000, Single Cell Western Single Cell Western reported by an internal validation at a 1:20 dilution |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot |
| Classification | Polyclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18430841
|
Novus Biologicals
NBP1-89417-25ul |
25 μL |
€ 379.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18711214
|
Novus Biologicals
NBP1-89417 |
0.1 mL |
€ 539.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC22A2/OCT2 Polyclonal specifically detects SLC22A2/OCT2 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Single Cell Western.Specifications
| SLC22A2/OCT2 | |
| Western Blot Reactivity reported in scientific literature (PMID: 26045896)., Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000, Single Cell Western Single Cell Western reported by an internal validation at a 1:20 dilution | |
| Polyclonal | |
| Rabbit | |
| Human, Rat | |
| O15244 | |
| 6582 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| 63 kDa |
| 0.2mg/mL | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| hOCT2, MGC32628, OCT2Organic cation transporter 2, solute carrier family 22 (organic cation transporter), member 2, solute carrier family 22 member 2 | |
| SLC22A2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto