missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLCO2B1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94572-0.02ml
This item is not returnable.
View return policy
Description
SLCO2B1 Polyclonal antibody specifically detects SLCO2B1 in Human, Mouse samples. It is validated for Western Blot
Specifications
| SLCO2B1 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| OATP2B1OATP-RP2, OATPBDKFZp686E0517, OATP-BKIAA0880, OATPRP2, Organic anion transporter B, Organic anion transporter polypeptide-related protein 2, SLC21A9solute carrier organic anion transporter family member 2B1, solute carrier family 21 (organic anion transporter), member 9, Solute carrier family 21 member 9, solute carrier organic anion transporter family, member 2B1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 130-210 of human SLCO2B1 (NP_009187.1). LLMTLPHFISEPYRYDNTSPEDMPQDFKASLCLPTTSAPASAPSNGNCSSYTETQHLSVVGIMFVAQTLLGVGGVPIQPFG | |
| 0.02 mL | |
| Cancer, Cell Biology, Endocrinology, Neuroscience, Signal Transduction | |
| 11309 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction