missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLCO2B1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 201.00 - € 470.00
Specifications
| Antigen | SLCO2B1 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18695320
|
Novus Biologicals
NBP2-94572-0.02ml |
0.02 mL |
€ 201.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18643591
|
Novus Biologicals
NBP2-94572-0.1ml |
0.1 mL |
€ 470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLCO2B1 Polyclonal antibody specifically detects SLCO2B1 in Human, Mouse samples. It is validated for Western BlotSpecifications
| SLCO2B1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cell Biology, Endocrinology, Neuroscience, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 11309 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| OATP2B1OATP-RP2, OATPBDKFZp686E0517, OATP-BKIAA0880, OATPRP2, Organic anion transporter B, Organic anion transporter polypeptide-related protein 2, SLC21A9solute carrier organic anion transporter family member 2B1, solute carrier family 21 (organic anion transporter), member 9, Solute carrier family 21 member 9, solute carrier organic anion transporter family, member 2B1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 130-210 of human SLCO2B1 (NP_009187.1). LLMTLPHFISEPYRYDNTSPEDMPQDFKASLCLPTTSAPASAPSNGNCSSYTETQHLSVVGIMFVAQTLLGVGGVPIQPFG | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title