missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPACA3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-89136-25ul
This item is not returnable.
View return policy
Description
SPACA3 Polyclonal specifically detects SPACA3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| SPACA3 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| CT54ALLP17Cancer/testis antigen 54, LYC3Sperm protein reactive with ASA, Lysozyme-like acrosomal sperm-specific secretory protein ALLP-17, Lysozyme-like protein 3, lysozyme-like sperm-specific secretory protein ALLP17, LYZL31700025M08Rik, SLLP1MGC119058, sperm acrosome associated 3, sperm acrosome membrane-associated protein 3, sperm lysozyme like protein 1, Sperm lysozyme-like protein 1, Sperm protein reactive with antisperm antibodies, SPRASA | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 124912 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| SPACA3 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:TNNGIFQINSRRWCSNLTPNVPNVCRMYCSDLLNPNLKDTVICAMKITQEPQGLGYWEAWRHHCQGKDLTEWVDGCDF | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction