missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPACA5B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-46703-25ul
This item is not returnable.
View return policy
Description
SPACA5B Polyclonal antibody specifically detects SPACA5B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| SPACA5B | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Lysozyme-Like Protein 5, LYZL5, LYZL5B, SLLP-X, SPACA5 SPACA5B, SPACA5A, Sperm Acrosome Associated 5B, Sperm Acrosome-Associated Protein 5, Sperm-Specific Lysozyme-Like Protein X | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: AGLNGYKGYGVGDWLCMAHYESGFDTAFVDHNPDGSSEYGIFQLNSAWWCDNGITPTKNLC | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 729201 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction