missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SQLE Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 483.00
Specifications
| Antigen | SQLE |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50-1:100, Immunocytochemistry/ Immunofluorescence 1:50-1:100, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18690751
|
Novus Biologicals
NBP2-93808-0.02ml |
0.02 mL |
€ 190.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18613991
|
Novus Biologicals
NBP2-93808-0.1ml |
0.1 mL |
€ 483.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SQLE Polyclonal antibody specifically detects SQLE in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| SQLE | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| PBS (pH 7.3), 50% glycerol | |
| 6713 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50-1:100, Immunocytochemistry/ Immunofluorescence 1:50-1:100, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| EC 1.14.99.7, ERG1, FLJ30795, squalene epoxidaseSE, squalene monooxygenase | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human SQLE (NP_003120.2). VSVSSHFVGFLMKNAPQFKANHAELILANPSPVLIYQISSSETRVLVDIRGEMPRNLREYMVEKIYPQIPDHLKEPFLEATDNSHLRSMPASFLPPSSVKK | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title