missing translation for 'onlineSavingsMsg'
Learn More
Learn More
STAM-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38514-25ul
This item is not returnable.
View return policy
Description
STAM-1 Polyclonal specifically detects STAM-1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| STAM-1 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q92783 | |
| STAM | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANK | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DKFZp686J2352, HSE1 homolog, signal transducing adapter molecule 1, signal transducing adaptor molecule (SH3 domain and ITAM motif) 1, STAM1STAM-1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 8027 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Ser du en mulighed for forbedring?Del en indholdskorrektion