missing translation for 'onlineSavingsMsg'
Learn More
Learn More
STIL Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93458-0.1ml
This item is not returnable.
View return policy
Description
STIL Polyclonal antibody specifically detects STIL in Human samples. It is validated for Western Blot
Specifications
| STIL | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| MCPH7, SCL/TAL1 Interrupting Locus, SCL-Interrupting Locus Protein, SIL, TAL1 (SCL) Interrupting Locus, TAL-1-Interrupting Locus Protein | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1218-1287 of human STIL (NP_003026.2). LVKNLKPSPAVNLRTGKAEFTQHPEKENEGDITIFPESLQPSETLKQMNSMNSVGTFLDVKRLRQLPKLF | |
| 0.1 mL | |
| Cell Biology, Cell Cycle and Replication, Stem Cells | |
| 6491 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur