missing translation for 'onlineSavingsMsg'
Learn More
Learn More
STIL Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 198.00 - € 468.00
Specifications
| Antigen | STIL |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
STIL Polyclonal antibody specifically detects STIL in Human samples. It is validated for Western BlotSpecifications
| STIL | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cell Cycle and Replication, Stem Cells | |
| PBS (pH 7.3), 50% glycerol | |
| 6491 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| MCPH7, SCL/TAL1 Interrupting Locus, SCL-Interrupting Locus Protein, SIL, TAL1 (SCL) Interrupting Locus, TAL-1-Interrupting Locus Protein | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1218-1287 of human STIL (NP_003026.2). LVKNLKPSPAVNLRTGKAEFTQHPEKENEGDITIFPESLQPSETLKQMNSMNSVGTFLDVKRLRQLPKLF | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title