missing translation for 'onlineSavingsMsg'
Learn More
Learn More
STK35 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | STK35 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18433572
|
Novus Biologicals
NBP2-30644-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18184335
|
Novus Biologicals
NBP2-30644 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
STK35 Polyclonal specifically detects STK35 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| STK35 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q8TDR2 | |
| 140901 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TSLKRRHQNVVQFEECVLQRNGLAQRMSHGNKSSQLYLRLVET | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| bA550O8.2, CLIK-1, CLIK1Serine/threonine-protein kinase 35 L1, CLP-36 interacting kinase, CLP-36-interacting kinase 1, EC 2.7.11, EC 2.7.11.1, PDIK1, PDLIM1-interacting kinase 1, serine threonine kinase 35 long form, serine/threonine kinase 35, serine/threonine-protein kinase 35, STK35L1 | |
| STK35 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title