missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TAF6 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 188.00 - € 470.00
Specifications
| Antigen | TAF6 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18663972
|
Novus Biologicals
NBP2-95182-0.02ml |
0.02 mL |
€ 188.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18614962
|
Novus Biologicals
NBP2-95182-0.1ml |
0.1 mL |
€ 470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TAF6 Polyclonal antibody specifically detects TAF6 in Mouse samples. It is validated for Western BlotSpecifications
| TAF6 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| DKFZp781E21155, MGC:8964, RNA polymerase II, E, 70/85kD, TAF(II)70, TAF(II)80, TAF2ERNA polymerase II TBP-associated factor subunit E, TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa, TAFII70TAFII-80, TAFII80TAFII-70, TAFII85, Transcription initiation factor TFIID 70 kDa subunit, Transcription initiation factor TFIID 80 kDa subunit, transcription initiation factor TFIID subunit 6 | |
| A synthetic peptide corresponding to a sequence within amino acids 350-450 of human TAF6 (XP_006716164.1). TKSWVDEKTPWTTRYGSIAGLAELGHDVIKTLILPRLQQEGERIRSVLDGPVLSNIDRIGADHVQSLLLKHCAPVLAKLRPPPDNQDAYRAEFGSLGPLLC | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 6878 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title