missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tafazzin/TAZ Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-88511
This item is not returnable.
View return policy
Description
Tafazzin/TAZ Polyclonal antibody specifically detects Tafazzin/TAZ in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Tafazzin/TAZ | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| BTHSEFE, cardiomyopathy, dilated 3A (X-linked), CMD3A, EFE2FLJ27390, G4.5endocardial fibroelastosis 2, LVNCX, Protein G4.5, tafazzin, Taz1, XAP-2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: WHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQP | |
| 0.1 mL | |
| Transcription Factors and Regulators | |
| 6901 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?