missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tafazzin/TAZ Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 529.00
Specifications
| Antigen | Tafazzin/TAZ |
|---|---|
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18411181
|
Novus Biologicals
NBP1-88511 |
0.1 mL |
€ 529.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18462651
|
Novus Biologicals
NBP1-88511-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Tafazzin/TAZ Polyclonal antibody specifically detects Tafazzin/TAZ in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Tafazzin/TAZ | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Transcription Factors and Regulators | |
| PBS (pH 7.2) and 40% Glycerol | |
| 6901 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| BTHSEFE, cardiomyopathy, dilated 3A (X-linked), CMD3A, EFE2FLJ27390, G4.5endocardial fibroelastosis 2, LVNCX, Protein G4.5, tafazzin, Taz1, XAP-2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: WHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title