missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tafazzin/TAZ Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-88511
This item is not returnable.
View return policy
Description
Tafazzin/TAZ Polyclonal antibody specifically detects Tafazzin/TAZ in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Tafazzin/TAZ | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| BTHSEFE, cardiomyopathy, dilated 3A (X-linked), CMD3A, EFE2FLJ27390, G4.5endocardial fibroelastosis 2, LVNCX, Protein G4.5, tafazzin, Taz1, XAP-2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: WHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQP | |
| 0.1 mL | |
| Transcription Factors and Regulators | |
| 6901 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction