missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TBL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35499-20ul
This item is not returnable.
View return policy
Description
TBL1 Polyclonal antibody specifically detects TBL1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| TBL1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| EBI, SMAP55, TBL1transducin (beta)-like 1, transducin (beta)-like 1X-linked, X-linked | |
| A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TBL1 (NP_005638.1).,, Sequence:, LISILQKGLQYVEAEISINEDGTVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQASAAAAAAAATAAATAATTTSAGVSHQNPSKNREATVNGEEN | |
| 20 μL | |
| Wnt Signaling Pathway | |
| 6907 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?