missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TBL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 550.00
Specifications
| Antigen | TBL1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30229654
|
Novus Biologicals
NBP3-35499-100ul |
100 μL |
€ 550.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30228197
|
Novus Biologicals
NBP3-35499-20ul |
20 μL |
€ 190.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TBL1 Polyclonal antibody specifically detects TBL1 in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| TBL1 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Wnt Signaling Pathway | |
| PBS (pH 7.3), 50% glycerol | |
| 6907 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| EBI, SMAP55, TBL1transducin (beta)-like 1, transducin (beta)-like 1X-linked, X-linked | |
| A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TBL1 (NP_005638.1).,, Sequence:, LISILQKGLQYVEAEISINEDGTVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQASAAAAAAAATAAATAATTTSAGVSHQNPSKNREATVNGEEN | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title