missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEM49 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93149-0.02ml
This item is not returnable.
View return policy
Description
TMEM49 Polyclonal antibody specifically detects TMEM49 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| TMEM49 | |
| Polyclonal | |
| Western Blot 1:200-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| DKFZp566I133, EPG3, TDC1, transmembrane protein 49TMEM49, vacuole membrane protein 1 | |
| A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human VMP1 (NP_112200.2). KMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSYAKRIQQRLNSEEKTK | |
| 0.02 mL | |
| Autophagy, Cancer, ER Markers, Membrane Trafficking and Chaperones, Neurodegeneration | |
| 81671 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction