missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEM49 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 198.00 - € 468.00
Specifications
| Antigen | TMEM49 |
|---|---|
| Dilution | Western Blot 1:200-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
TMEM49 Polyclonal antibody specifically detects TMEM49 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| TMEM49 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Autophagy, Cancer, ER Markers, Membrane Trafficking and Chaperones, Neurodegeneration | |
| PBS (pH 7.3), 50% glycerol | |
| 81671 | |
| IgG | |
| Affinity purified |
| Western Blot 1:200-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| DKFZp566I133, EPG3, TDC1, transmembrane protein 49TMEM49, vacuole membrane protein 1 | |
| A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human VMP1 (NP_112200.2). KMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSYAKRIQQRLNSEEKTK | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title