missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TNS3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-37952
This item is not returnable.
View return policy
Description
TNS3 Polyclonal specifically detects TNS3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| TNS3 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Q68CZ2 | |
| TNS3 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VGSGPHPPDTQQPSPSKAFKPRFPGDQVVNGAGPELSTGPSPGSPTLDIDQSIEQLNRLILELDPTFEPIPTHMNALGSQANGSV | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| TEM6, TENS1, Tensin 3, tensin-3, Tensin-Like SH2 Domain Containing 1, Tensin-Like SH2 Domain-Containing 1, Tensin-Like SH2 Domain-Containing Protein 1, Thyroid Specific PTB Domain Protein, TPP, Tumor Endothelial Marker 6 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 64759 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering