missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TNS3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 288.00 - € 589.00
Specifications
| Antigen | TNS3 |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18692486
|
Novus Biologicals
NBP2-37952-25ul |
25 μL |
€ 288.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18167358
|
Novus Biologicals
NBP2-37952 |
0.1 mL |
€ 589.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TNS3 Polyclonal specifically detects TNS3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| TNS3 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q68CZ2 | |
| 64759 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VGSGPHPPDTQQPSPSKAFKPRFPGDQVVNGAGPELSTGPSPGSPTLDIDQSIEQLNRLILELDPTFEPIPTHMNALGSQANGSV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| TEM6, TENS1, Tensin 3, tensin-3, Tensin-Like SH2 Domain Containing 1, Tensin-Like SH2 Domain-Containing 1, Tensin-Like SH2 Domain-Containing Protein 1, Thyroid Specific PTB Domain Protein, TPP, Tumor Endothelial Marker 6 | |
| TNS3 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title