missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRAIL/TNFSF10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38744
This item is not returnable.
View return policy
Description
TRAIL/TNFSF10 Polyclonal specifically detects TRAIL/TNFSF10 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| TRAIL/TNFSF10 | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| P50591 | |
| TNFSF10 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEAS | |
| 0.1 mL | |
| Apoptosis, Cancer, Cell Biology, Death Receptor Signaling Pathway, Signal Transduction, Tumor Suppressors | |
| 8743 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Apo-2 ligand, APO2L, Apo-2Ltumor necrosis factor (ligand) family, member 10, APO2Ltumor necrosis factor apoptosis-inducing ligand splice variant delta, CD253, CD253 antigen, Protein TRAIL, TL2, TNF-related apoptosis-inducing ligand, TRAILTNF-related apoptosis inducing ligand TRAIL, tumor necrosis factor (ligand) superfamily, member 10, tumor necrosis factor ligand superfamily member 10 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction