missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRAIL/TNFSF10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 302.00 - € 500.00
Specifications
| Antigen | TRAIL/TNFSF10 |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|
18692566
|
Novus Biologicals
NBP2-38744-25ul |
25 μL |
€ 302.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18105499
|
Novus Biologicals
NBP2-38744 |
0.1 mL |
€ 500.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
TRAIL/TNFSF10 Polyclonal specifically detects TRAIL/TNFSF10 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Spezifikation
| TRAIL/TNFSF10 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer, Cell Biology, Death Receptor Signaling Pathway, Signal Transduction, Tumor Suppressors | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Apo-2 ligand, APO2L, Apo-2Ltumor necrosis factor (ligand) family, member 10, APO2Ltumor necrosis factor apoptosis-inducing ligand splice variant delta, CD253, CD253 antigen, Protein TRAIL, TL2, TNF-related apoptosis-inducing ligand, TRAILTNF-related apoptosis inducing ligand TRAIL, tumor necrosis factor (ligand) superfamily, member 10, tumor necrosis factor ligand superfamily member 10 | |
| TNFSF10 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P50591 | |
| 8743 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEAS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts