missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRIM5 alpha Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35889-100ul
This item is not returnable.
View return policy
Description
TRIM5 alpha Polyclonal antibody specifically detects TRIM5 alpha in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
| TRIM5 alpha | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| EC 6.3.2, EC 6.3.2.-, RING finger protein 88, RNF88tripartite motif protein TRIM, TRIM5alpha, tripartite motif containing 5, tripartite motif protein TRIM5, tripartite motif-containing 5, tripartite motif-containing protein 5 | |
| A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TRIM5 alpha (NP_149083.2).,, Sequence:, EKLLLFCQEDGKVICWLCERSQEHRGHHTFLTEEVAREYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNEL | |
| 100 μL | |
| Immunology, Lipid and Metabolism, Virology Bacteria and Parasites, Zinc Finger | |
| 85363 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction