missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRIM5 alpha Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 550.00
Specifications
| Antigen | TRIM5 alpha |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30231434
|
Novus Biologicals
NBP3-35889-20ul |
20 μL |
€ 190.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30231632
|
Novus Biologicals
NBP3-35889-100ul |
100 μL |
€ 550.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TRIM5 alpha Polyclonal antibody specifically detects TRIM5 alpha in Human,Mouse samples. It is validated for ELISA,Western BlotSpecifications
| TRIM5 alpha | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Immunology, Lipid and Metabolism, Virology Bacteria and Parasites, Zinc Finger | |
| PBS (pH 7.3), 50% glycerol | |
| 85363 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| EC 6.3.2, EC 6.3.2.-, RING finger protein 88, RNF88tripartite motif protein TRIM, TRIM5alpha, tripartite motif containing 5, tripartite motif protein TRIM5, tripartite motif-containing 5, tripartite motif-containing protein 5 | |
| A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TRIM5 alpha (NP_149083.2).,, Sequence:, EKLLLFCQEDGKVICWLCERSQEHRGHHTFLTEEVAREYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNEL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title