missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TYW1B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | TYW1 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18647185
|
Novus Biologicals
NBP2-38563-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18182879
|
Novus Biologicals
NBP2-38563 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TYW1B Polyclonal specifically detects TYW1B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TYW1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| LINC00069, Long Intergenic Non-Protein Coding RNA 69, NCRNA00069, Non-Protein Coding RNA 69, Radical S-Adenosyl Methionine And Flavodoxin Domain-Containing Protein 2, radical S-adenosyl methionine and flavodoxin domains 1, RSAFD2, S-Adenosyl-L-Methionine-Dependent TRNA 4-Demethylwyosine Synthase, TRNA Wybutosine-Synthesizing Protein 1 Homolog B TRNA-YW Synthesizing Protein 1 Homolog B, TRNA-YW Synthesizing Protein 1 Homolog B (Non-Protein Coding), TRNA-YW Synthesizing Protein 1 Homolog B (S. Cerevisiae) | |
| TYW1 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q9NV66 | |
| 55253 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RVMSRGEGDCDVVKSKHGSIEANFRAWKTKFISQLQALQKGERKKSCGGHCKKGKCESHQHGSEEREEGSQEQDELHHR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title