missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UAF1/WDR48 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 360.00 - € 529.00
Specifications
| Antigen | UAF1/WDR48 |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18673169
|
Novus Biologicals
NBP2-49269-25ul |
25 μg |
€ 360.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18603109
|
Novus Biologicals
NBP2-49269 |
0.1 mL |
€ 529.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
UAF1/WDR48 Polyclonal antibody specifically detects UAF1/WDR48 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| UAF1/WDR48 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cell Biology | |
| PBS (pH 7.2), 40% Glycerol | |
| 57599 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| KIAA1449DKFZp686G1794, P80, UAF1, USP1 associated factor 1, USP1-associated factor 1, WD repeat domain 48, WD repeat endosomal protein, WD repeat-containing protein 48 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SDMLQVRKVMEHVYEKIINLDNESQTTSSSNNEKPGEQEKEEDIAVLAEEKIELLCQDQVLDPNMDLRTVKHFIWKSGGDLTLHYR | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title