missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UBE2NL Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-05571-100ul
This item is not returnable.
View return policy
Description
UBE2NL Polyclonal antibody specifically detects UBE2NL in Human, Mouse samples. It is validated for Western Blot
Specifications
| UBE2NL | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| epididymis tissue protein Li 174, Li174, putative ubiquitin-conjugating enzyme E2 N-like, ubiquitin conjugating enzyme E2N-like | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human UBE2NL (NP_001013007.1). MAELPHRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGESKDSPFEGGTFKRELLLAEEYPMAAPKVRFMTKIYHPNVDKLERISLDILKDKWSPAL | |
| 100 μg | |
| Cell Biology | |
| 389898 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction