missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UBE2NL Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 188.00 - € 463.00
Specifications
| Antigen | UBE2NL |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18693799
|
Novus Biologicals
NBP3-05571-100ul |
100 μg |
€ 463.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18685896
|
Novus Biologicals
NBP3-05571-20ul |
20 μg |
€ 188.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
UBE2NL Polyclonal antibody specifically detects UBE2NL in Human, Mouse samples. It is validated for Western BlotSpecifications
| UBE2NL | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology | |
| PBS with 50% glycerol, pH7.3. | |
| 389898 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| epididymis tissue protein Li 174, Li174, putative ubiquitin-conjugating enzyme E2 N-like, ubiquitin conjugating enzyme E2N-like | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human UBE2NL (NP_001013007.1). MAELPHRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGESKDSPFEGGTFKRELLLAEEYPMAAPKVRFMTKIYHPNVDKLERISLDILKDKWSPAL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title