missing translation for 'onlineSavingsMsg'
Learn More
Learn More
USAG1/SOSTDC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 483.00
Specifications
| Antigen | USAG1/SOSTDC1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
USAG1/SOSTDC1 Polyclonal specifically detects USAG1/SOSTDC1 in Human samples. It is validated for Western Blot.Specifications
| USAG1/SOSTDC1 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| cystine-knot containing secreted protein, DKFZp564D206, Ectodermal BMP inhibitor, ECTODIN, sclerostin domain containing 1, sclerostin domain-containing protein 1, USAG-1, USAG1uterine sensitization-associated protein-1, Uterine sensitization-associated gene 1 protein | |
| SOSTDC1 | |
| IgG | |
| 21 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_056279 | |
| 25928 | |
| The immunogen for this antibody is SOSTDC1 - C-terminal region. Peptide sequence ITVVTACKCKRYTRQHNESSHNFESMSPAKPVQHHRERKRASKSSKHSMS. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title