missing translation for 'onlineSavingsMsg'
Learn More
Learn More
VAMP3/Cellubrevin Rabbit anti-Human, Mouse, Clone: 2H8R8, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-16705-20UL
This item is not returnable.
View return policy
Description
VAMP3/Cellubrevin Monoclonal antibody specifically detects VAMP3/Cellubrevin in Human, Mouse samples. It is validated for Western Blot, Immunofluorescence
Specifications
| VAMP3/Cellubrevin | |
| Monoclonal | |
| Unconjugated | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
| Western Blot, Immunofluorescence | |
| 2H8R8 | |
| Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| CEBCellubrevin, cellubrevin, SYB3, Synaptobrevin-3, VAMP-3, vesicle-associated membrane protein 3, vesicle-associated membrane protein 3 (cellubrevin) | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human VAMP3/Cellubrevin (Q15836). MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS | |
| 20 μg | |
| Membrane Trafficking and Chaperones, Neuronal Cell Markers, Neurotransmission | |
| 9341 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction