missing translation for 'onlineSavingsMsg'
Learn More
Learn More
VAMP3/Cellubrevin Rabbit anti-Human, Mouse, Clone: 2H8R8, Novus Biologicals™
Rabbit Monoclonal Antibody
€ 196.00 - € 496.00
Specifications
| Antigen | VAMP3/Cellubrevin |
|---|---|
| Clone | 2H8R8 |
| Dilution | Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18055525
|
Novus Biologicals
NBP3-16705-20UL |
20 μg |
€ 196.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18332047
|
Novus Biologicals
NBP3-16705-100UL |
100 μg |
€ 496.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
VAMP3/Cellubrevin Monoclonal antibody specifically detects VAMP3/Cellubrevin in Human, Mouse samples. It is validated for Western Blot, ImmunofluorescenceSpecifications
| VAMP3/Cellubrevin | |
| Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| CEBCellubrevin, cellubrevin, SYB3, Synaptobrevin-3, VAMP-3, vesicle-associated membrane protein 3, vesicle-associated membrane protein 3 (cellubrevin) | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human VAMP3/Cellubrevin (Q15836). MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| 2H8R8 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Membrane Trafficking and Chaperones, Neuronal Cell Markers, Neurotransmission | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| 9341 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title