missing translation for 'onlineSavingsMsg'
Learn More
Learn More
VPS26A Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93897-0.1ml
This item is not returnable.
View return policy
Description
VPS26A Polyclonal antibody specifically detects VPS26A in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| VPS26A | |
| Polyclonal | |
| Western Blot 1:100 - 1:500, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| FLJ12930, HB58, Hbeta58, hVPS26, PEP8A, vacuolar protein sorting 26 (yeast homolog), vacuolar protein sorting 26 homolog A (S. pombe), vacuolar protein sorting 26 homolog A (yeast), vacuolar protein sorting-associated protein 26A, Vesicle protein sorting 26A, VPS26vacuolar protein sorting 26 (yeast) | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 256-327 of human VPS26A (NP_004887.2). DPTPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPESQASAEQPEM | |
| 0.1 mL | |
| Autophagy | |
| 9559 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction