missing translation for 'onlineSavingsMsg'
Learn More
Learn More
VPS26A Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 188.00 - € 470.00
Specifications
| Antigen | VPS26A |
|---|---|
| Dilution | Western Blot 1:100 - 1:500, Immunocytochemistry/ Immunofluorescence 1:50-1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18647250
|
Novus Biologicals
NBP2-93897-0.02ml |
0.02 mL |
€ 188.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18675430
|
Novus Biologicals
NBP2-93897-0.1ml |
0.1 mL |
€ 470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
VPS26A Polyclonal antibody specifically detects VPS26A in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| VPS26A | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Autophagy | |
| PBS (pH 7.3), 50% glycerol | |
| 9559 | |
| IgG | |
| Affinity purified |
| Western Blot 1:100 - 1:500, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| FLJ12930, HB58, Hbeta58, hVPS26, PEP8A, vacuolar protein sorting 26 (yeast homolog), vacuolar protein sorting 26 homolog A (S. pombe), vacuolar protein sorting 26 homolog A (yeast), vacuolar protein sorting-associated protein 26A, Vesicle protein sorting 26A, VPS26vacuolar protein sorting 26 (yeast) | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 256-327 of human VPS26A (NP_004887.2). DPTPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPESQASAEQPEM | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title