missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF354A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13568
This item is not returnable.
View return policy
Description
ZNF354A Polyclonal specifically detects ZNF354A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| ZNF354A | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 | |
| G0/G1 switch regulatory protein 24, G0S24tristetraprolin, Growth factor-inducible nuclear protein NUP475, NUP475, Protein TIS11A, RNF162Atristetraproline, TIS11A, TIS11zfp-36, TTPGOS24, Zfp-36, Zinc finger protein 36 homolog, zinc finger protein 36, C3H type, homolog (mouse), zinc finger protein, C3H type, 36 homolog, zinc finger protein, C3H type, 36 homolog (mouse) | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 6940 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ZNF354A | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: TQDSSFQGLILKRSNRNVPWDLKLEKPYIYEGRLEKKQDKKGSFQIVSATHKKIPTIERSHKNTELSQNFSPKSVLIRQQILPR | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction